Sequence:
HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG-CONH2
Molecular Formula:
C435H682N116O127S2
Molecular Weight:
9647.18 g/mol
CAS Number:
2206440-11-0
PubChem CID:
161345906
Appearance:
White Powder
Storage:
2-8°C
Disclaimer: For Research Purposes Only
This content is provided strictly for research purposes and does not constitute an endorsement or recommendation for the non-laboratory application or improper handling of peptides designed for research. The information, including discussions about specific peptides and their researched benefits, is presented for informational purposes only and must not be construed as health, clinical, or legal guidance, nor an encouragement for non-research use in humans. Peptides described here are solely for use in structured scientific study by authorized individuals. Any deviation or unauthorized use could lead to legal and health implications. We advise consulting with research experts, medical practitioners, or legal counsel prior to any decisions about obtaining or utilizing these peptides. The expectation of responsible, ethical utilization of this information for legitimate investigative and scholarly objectives is paramount. This notice is dynamic and governs all provided content on research peptides.