Mazdu 6mg

This item is selling fast!
Categories: , ,
Product Description

Sequence:
HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG

Molecular Formula:
C468H696N120O140S2

Molecular Weight:
10,508.63 g/mol

CAS Number:
2389142-76-9

PubChem CID:
161663586

Appearance:
White Powder

Storage:
2-8°C


Disclaimer: For Research Purposes Only

This content is provided strictly for research purposes and does not constitute an endorsement or recommendation for the non-laboratory application or improper handling of peptides designed for research. The information, including discussions about specific peptides and their researched benefits, is presented for informational purposes only and must not be construed as health, clinical, or legal guidance, nor an encouragement for non-research use in humans. Peptides described here are solely for use in structured scientific study by authorized individuals. Any deviation or unauthorized use could lead to legal and health implications. We advise consulting with research experts, medical practitioners, or legal counsel prior to any decisions about obtaining or utilizing these peptides. The expectation of responsible, ethical utilization of this information for legitimate investigative and scholarly objectives is paramount. This notice is dynamic and governs all provided content on research peptides.

Lab Reports

Janoshik Purity & Test Results

Purity and content verification

Date August 1, 2024
Dosage Results 6.86 mg; 6.88 mg
Purity 99.194%; 99.952%

Chromate Labs Test Results

Third-party analysis documentation

Date August 5, 2024
Test Results 99.95%, 6.97 mg

Heavy Metals Analysis

Heavy metals screening documentation

Sterility Testing Analysis

Sterility test documentation

Date Of Analysis August 19, 2024
Test Results TAMC = PASS; TYMC = PASS.
[elementor-template id=”10045565″]